Shopping Cart
Your shopping cart is empty
Visit the shop
AP-E-01 Echistatin
N-term: NH2
Sequence: ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
(Modifications: Disulfide bridge between 2 – 11, 7 – 32, 8 – 37, 20 – 39)
C-term: Acid
Molecular Weight = 5417.1
Description:
The H-9019 peptide, also known as echistatin by scientific terminology, is a 49-amino acid polypeptide, or chain, with 4 cystine bridges from the venom of a snake, the saw-scaled viper (known as Echis carinatus). The polypeptide contains an RGD sequence that binds to glycoprotein receptors on platelets and inhibits ADP-stimulated platelet aggregation with IC50 = 3.3 x 10(-8) M. In addition, the peptide stimulates osteolastic bone resportion, both in vitro and in vivo; and, the reduction of purified synthetic echistatin to octahydroechistatin with dithiothreitol, combined with air oxidation, regenerated a quantitative yield of identical echistatin sequences.