Antimicrobial and Related Peptides Shopping Cart Your shopping cart is empty Visit the shop Default List Grid Sort: Select Ascending Descending Show: Select 10 per page20 per page50 per pageShow All AP-L-01 LL-37 Human N-term: NH2 Sequence: [LL-37, 37 aa] C-term: Acid Product Options AP-L-01 Weight: — Please Select — 1mg Combination of product variants is not available Quantity Price: $100.00 Updating cart… Updating…